Files
flowdock/params.json
Olamide Isreal a3ffec6a07
Some checks failed
Code Quality Main / code-quality (push) Has been cancelled
Release Drafter / update_release_draft (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.10) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.8) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.9) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.10) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.8) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.9) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.10) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.8) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.9) (push) Has been cancelled
Tests / code-coverage (push) Has been cancelled
Initial commit: FlowDock pipeline configured for WES execution
2026-03-16 15:23:29 +01:00

102 lines
4.0 KiB
JSON

{
"params": {
"input_receptor": {
"type": "string",
"description": "Protein sequence(s) in single-letter amino acid code. Multiple chains separated by '|'",
"default": "YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV",
"required": true,
"pipeline_io": "input",
"var_name": "params.input_receptor",
"examples": [
"YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV",
"MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP|MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP"
],
"pattern": "^[ACDEFGHIKLMNPQRSTVWY|]+$",
"enum": [],
"validation": {},
"notes": "For multi-chain proteins, separate sequences with '|' character."
},
"input_ligand": {
"type": "string",
"description": "Ligand SMILES string for docking",
"default": "c1cc2c(cc1O)CCCC2",
"required": true,
"pipeline_io": "input",
"var_name": "params.input_ligand",
"examples": [
"c1cc2c(cc1O)CCCC2",
"CC(=O)NC1C(O)OC(CO)C(OC2OC(CO)C(O)C(O)C2NC(C)=O)C1O"
],
"pattern": ".*",
"enum": [],
"validation": {},
"notes": "SMILES notation for the ligand molecule."
},
"input_template": {
"type": "file",
"description": "Optional template PDB structure for protein. If empty, ESMFold will predict the structure",
"default": "",
"required": false,
"pipeline_io": "input",
"var_name": "params.input_template",
"examples": [
"/path/to/template.pdb",
""
],
"pattern": ".*\\.pdb$",
"enum": [],
"validation": {},
"notes": "Providing a template can improve docking quality. Leave empty to use ESMFold-predicted structure."
},
"sample_id": {
"type": "string",
"description": "Unique identifier for the prediction sample",
"default": "flowdock_sample",
"required": false,
"pipeline_io": "parameter",
"var_name": "params.sample_id",
"examples": [
"6i67",
"T1152",
"my_protein_ligand"
],
"pattern": "^[a-zA-Z0-9_-]+$",
"enum": [],
"validation": {},
"notes": "Used for naming output directories and files."
},
"outdir": {
"type": "folder",
"description": "Directory for FlowDock output results",
"default": "s3://omic/eureka/flowdock/output/",
"required": true,
"pipeline_io": "output",
"var_name": "params.outdir",
"examples": [
"./flowdock_output",
"/data/predictions/flowdock"
],
"pattern": ".*",
"enum": [],
"validation": {},
"notes": "Directory where PDB structures and logs will be stored."
},
"n_samples": {
"type": "integer",
"description": "Number of prediction samples to generate",
"default": 5,
"required": false,
"pipeline_io": "parameter",
"var_name": "params.n_samples",
"examples": [1, 5, 10, 40],
"pattern": "^[1-9][0-9]*$",
"enum": [],
"validation": {
"min": 1,
"max": 100
},
"notes": "Higher values provide more conformational diversity but increase computation time."
}
}
}