Some checks failed
Code Quality Main / code-quality (push) Has been cancelled
Release Drafter / update_release_draft (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.10) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.8) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.9) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.10) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.8) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.9) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.10) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.8) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.9) (push) Has been cancelled
Tests / code-coverage (push) Has been cancelled
102 lines
4.0 KiB
JSON
102 lines
4.0 KiB
JSON
{
|
|
"params": {
|
|
"input_receptor": {
|
|
"type": "string",
|
|
"description": "Protein sequence(s) in single-letter amino acid code. Multiple chains separated by '|'",
|
|
"default": "YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV",
|
|
"required": true,
|
|
"pipeline_io": "input",
|
|
"var_name": "params.input_receptor",
|
|
"examples": [
|
|
"YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV",
|
|
"MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP|MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP"
|
|
],
|
|
"pattern": "^[ACDEFGHIKLMNPQRSTVWY|]+$",
|
|
"enum": [],
|
|
"validation": {},
|
|
"notes": "For multi-chain proteins, separate sequences with '|' character."
|
|
},
|
|
"input_ligand": {
|
|
"type": "string",
|
|
"description": "Ligand SMILES string for docking",
|
|
"default": "c1cc2c(cc1O)CCCC2",
|
|
"required": true,
|
|
"pipeline_io": "input",
|
|
"var_name": "params.input_ligand",
|
|
"examples": [
|
|
"c1cc2c(cc1O)CCCC2",
|
|
"CC(=O)NC1C(O)OC(CO)C(OC2OC(CO)C(O)C(O)C2NC(C)=O)C1O"
|
|
],
|
|
"pattern": ".*",
|
|
"enum": [],
|
|
"validation": {},
|
|
"notes": "SMILES notation for the ligand molecule."
|
|
},
|
|
"input_template": {
|
|
"type": "file",
|
|
"description": "Optional template PDB structure for protein. If empty, ESMFold will predict the structure",
|
|
"default": "",
|
|
"required": false,
|
|
"pipeline_io": "input",
|
|
"var_name": "params.input_template",
|
|
"examples": [
|
|
"/path/to/template.pdb",
|
|
""
|
|
],
|
|
"pattern": ".*\\.pdb$",
|
|
"enum": [],
|
|
"validation": {},
|
|
"notes": "Providing a template can improve docking quality. Leave empty to use ESMFold-predicted structure."
|
|
},
|
|
"sample_id": {
|
|
"type": "string",
|
|
"description": "Unique identifier for the prediction sample",
|
|
"default": "flowdock_sample",
|
|
"required": false,
|
|
"pipeline_io": "parameter",
|
|
"var_name": "params.sample_id",
|
|
"examples": [
|
|
"6i67",
|
|
"T1152",
|
|
"my_protein_ligand"
|
|
],
|
|
"pattern": "^[a-zA-Z0-9_-]+$",
|
|
"enum": [],
|
|
"validation": {},
|
|
"notes": "Used for naming output directories and files."
|
|
},
|
|
"outdir": {
|
|
"type": "folder",
|
|
"description": "Directory for FlowDock output results",
|
|
"default": "s3://omic/eureka/flowdock/output/",
|
|
"required": true,
|
|
"pipeline_io": "output",
|
|
"var_name": "params.outdir",
|
|
"examples": [
|
|
"./flowdock_output",
|
|
"/data/predictions/flowdock"
|
|
],
|
|
"pattern": ".*",
|
|
"enum": [],
|
|
"validation": {},
|
|
"notes": "Directory where PDB structures and logs will be stored."
|
|
},
|
|
"n_samples": {
|
|
"type": "integer",
|
|
"description": "Number of prediction samples to generate",
|
|
"default": 5,
|
|
"required": false,
|
|
"pipeline_io": "parameter",
|
|
"var_name": "params.n_samples",
|
|
"examples": [1, 5, 10, 40],
|
|
"pattern": "^[1-9][0-9]*$",
|
|
"enum": [],
|
|
"validation": {
|
|
"min": 1,
|
|
"max": 100
|
|
},
|
|
"notes": "Higher values provide more conformational diversity but increase computation time."
|
|
}
|
|
}
|
|
}
|