Initial commit: FlowDock pipeline configured for WES execution
Some checks failed
Code Quality Main / code-quality (push) Has been cancelled
Release Drafter / update_release_draft (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.10) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.8) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.9) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.10) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.8) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.9) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.10) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.8) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.9) (push) Has been cancelled
Tests / code-coverage (push) Has been cancelled

This commit is contained in:
2026-03-16 15:23:29 +01:00
commit a3ffec6a07
116 changed files with 16139 additions and 0 deletions

34
nextflow.config Normal file
View File

@@ -0,0 +1,34 @@
manifest {
name = 'FlowDock-Nextflow'
author = 'BioinfoMachineLearning'
homePage = 'https://github.com/BioinfoMachineLearning/FlowDock'
description = 'Nextflow pipeline for FlowDock - Geometric Flow Matching for Generative Protein-Ligand Docking and Affinity Prediction'
mainScript = 'main.nf'
version = '1.0.0'
}
params {
input_receptor = 'YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV'
input_ligand = 'c1cc2c(cc1O)CCCC2'
input_template = ''
sample_id = 'flowdock_sample'
outdir = 's3://omic/eureka/flowdock/output/'
n_samples = 5
}
docker {
enabled = true
runOptions = '--gpus all'
}
process {
cpus = 4
memory = '32 GB'
}
executor {
$local {
cpus = 8
memory = '64 GB'
}
}