Initial commit: FlowDock pipeline configured for WES execution
Some checks failed
Code Quality Main / code-quality (push) Has been cancelled
Release Drafter / update_release_draft (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.10) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.8) (push) Has been cancelled
Tests / run_tests_ubuntu (ubuntu-latest, 3.9) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.10) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.8) (push) Has been cancelled
Tests / run_tests_macos (macos-latest, 3.9) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.10) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.8) (push) Has been cancelled
Tests / run_tests_windows (windows-latest, 3.9) (push) Has been cancelled
Tests / code-coverage (push) Has been cancelled

This commit is contained in:
2026-03-16 15:23:29 +01:00
commit a3ffec6a07
116 changed files with 16139 additions and 0 deletions

74
main.nf Normal file
View File

@@ -0,0 +1,74 @@
#!/usr/bin/env nextflow
nextflow.enable.dsl=2
params.input_receptor = 'YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV'
params.input_ligand = 'c1cc2c(cc1O)CCCC2'
params.input_template = ''
params.sample_id = 'flowdock_sample'
params.outdir = 's3://omic/eureka/flowdock/output/'
params.n_samples = 5
process FLOWDOCK {
container 'harbor.cluster.omic.ai/omic/flowdock:latest'
containerOptions '--rm --gpus all'
publishDir params.outdir, mode: 'copy'
stageInMode 'copy'
input:
val receptor
val ligand
output:
path "${params.sample_id}/*.pdb", optional: true
path "${params.sample_id}/*.sdf", optional: true
path "${params.sample_id}/**/*.pdb", optional: true
path "run.log"
script:
"""
set +u
source /opt/conda/etc/profile.d/conda.sh
conda activate FlowDock
mkdir -p ${params.sample_id}
python /software/flowdock/flowdock/sample.py \\
ckpt_path=/software/flowdock/checkpoints/esmfold_prior_paper_weights-EMA.ckpt \\
model.cfg.prior_type=esmfold \\
sampling_task=batched_structure_sampling \\
input_receptor='${receptor}' \\
input_ligand='"${ligand}"' \\
${params.input_template ? "input_template=${params.input_template}" : "input_template=null"} \\
sample_id='${params.sample_id}' \\
out_path=\$PWD/${params.sample_id}/ \\
paths.output_dir=\$PWD/${params.sample_id}/ \\
hydra.run.dir=\$PWD/${params.sample_id}/ \\
n_samples=${params.n_samples} \\
chunk_size=5 \\
num_steps=40 \\
sampler=VDODE \\
sampler_eta=1.0 \\
start_time='1.0' \\
use_template=true \\
separate_pdb=true \\
visualize_sample_trajectories=false \\
auxiliary_estimation_only=false \\
esmfold_chunk_size=null \\
trainer=gpu 2>&1 | tee run.log
# Copy any outputs from FlowDock's log directory if they exist there
if ls /software/flowdock/logs/sample/runs/*/rank*.pdb 2>/dev/null; then
cp /software/flowdock/logs/sample/runs/*/rank*.pdb ${params.sample_id}/ 2>/dev/null || true
cp /software/flowdock/logs/sample/runs/*/rank*.sdf ${params.sample_id}/ 2>/dev/null || true
fi
# List what was generated
echo "=== Generated files ===" >> run.log
find ${params.sample_id}/ -type f >> run.log 2>&1 || true
"""
}
workflow {
FLOWDOCK(Channel.of(params.input_receptor), Channel.of(params.input_ligand))
}